PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001399-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 329aa    MW: 37125.5 Da    PI: 5.839
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001399-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-142471148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l  +    G g+W+ Iar  g+ R++k+c++rw +yl
  WALNUT_00001399-RA 24 KGLWSPEEDEKLMGYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 71
                        678*******************************************97 PP

2Myb_DNA-binding51.32.6e-1677121147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+++++E+el+v+ +  lG++ W+ Ia++++ gRt++++k++w++ 
  WALNUT_00001399-RA  77 RGAFSPQEEELIVHFHSILGNR-WSQIASRLP-GRTDNEIKNFWNST 121
                         89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0291971IPR017930Myb domain
SuperFamilySSF466898.59E-2822118IPR009057Homeodomain-like
SMARTSM007171.7E-92373IPR001005SANT/Myb domain
PfamPF002499.1E-132471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-232578IPR009057Homeodomain-like
CDDcd001672.19E-82771No hitNo description
PROSITE profilePS5129425.0872126IPR017930Myb domain
SMARTSM007177.0E-1676124IPR001005SANT/Myb domain
PfamPF002491.3E-1477121IPR001005SANT/Myb domain
CDDcd001672.72E-1179122No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2579127IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MRKPDQMIKE RVLKNSNNKS KLRKGLWSPE EDEKLMGYML TNGQGCWSDI ARNAGLQRCG  60
KSCRLRWINY LRPDLKRGAF SPQEEELIVH FHSILGNRWS QIASRLPGRT DNEIKNFWNS  120
TLKKRLKNNN SAPSPNDSDA SEPRDVIGGV MGLHEHENFI NMQCMDSFSS SSSSSSSMHT  180
LVTGSQFDPF SMLNDNRYDL TITGAARGLF NNIMPTGFAQ VGKGDVLYGD YGVLEPDNMG  240
LERDLSLPPL EIISRSIDEE DNAPVDHMKS NMSNHFNNGC FNSTEHQSFK VDNNLFGFGN  300
HGQGENLKIG EWDFEGLMQD LSSFPFLDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-272212625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047407.11e-135PREDICTED: transcription factor MYB46-like
TrEMBLA0A0E4B8Y51e-133A0A0E4B8Y5_9R
STRINGPOPTR_0009s06630.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-74myb domain protein 83